Protein Info for MCAODC_23920 in Escherichia coli ECRC101

Name: pgaA
Annotation: poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR03939: poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA" amino acids 17 to 585 (569 residues), 634.2 bits, see alignment E=1.7e-194 PF21197: PgaA_barrel" amino acids 514 to 585 (72 residues), 95.9 bits, see alignment E=2.5e-31

Best Hits

Predicted SEED Role

"Biofilm PGA outer membrane secretin PgaA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (585 amino acids)

>MCAODC_23920 poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA (Escherichia coli ECRC101)
MYSSSRKRCPKTKWALKLLTAAFLAASPAAKSAVNNAYDALIIEARKGNTQPALSWFALK
SALSNNQIADWLQIALWAGQDKQVITVYNRYRHQQLPARGYAAVAVAYRNLQQWQNSLTL
WQKALSLEPQNKDYQRGQILTLADAGHYDTALVKLKQLNSGAPDKANLLAEAYIYKLAGR
HQDELRAMTESLPENASTQQYPTEYVQALRNNQLAAAIDDANLTPDIRADIHAELVRLSF
MPTRSESERYAIADRALAQYAALEILWHDNPDRTAQYQRIQVDHLGALLTRDRYKDVISH
YQRLKKTGQIIPPWGQYWVASAYLKDHQPKKAQSIMTELFYHKETIAPDLSDEELADLFY
SHLESENYPGALTVTQHTINTSPPFLRLMGTPTSIPNDTWLQGHSFLSTVAKYSNDLPQA
EMTARELAYNAPGNQGLRIDYASVLQARGWPRAAENELKKAEVIEPRNINLEVEQAWTAL
TLQEWQQAAVLTHDVVEREPQDPGVVRLKRAVDVHNLAELRIAGSTGIDAEGPDSGKHDV
DLTTIVYSPPLKDNWRGFAGFGYADGQFSEGKGIVRDWLAGVEWR