Protein Info for MCAODC_23785 in Escherichia coli ECRC101

Name: lolD
Annotation: lipoprotein-releasing system ATP-binding protein LolD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 30 to 179 (150 residues), 122.5 bits, E=2.2e-39

Best Hits

Swiss-Prot: 45% identical to LOLD_LEGPL: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Legionella pneumophila (strain Lens)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to etw:ECSP_1219)

MetaCyc: 42% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"putative ATP binding protein of ABC transporter"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (6/7 steps found)

Protein Sequence (235 amino acids)

>MCAODC_23785 lipoprotein-releasing system ATP-binding protein LolD (Escherichia coli ECRC101)
MQSTIKSLPAISLSNIYKCYGAGAGKVDALKSINLDINKGEFLALCGPSGSGKSTLLNIL
SGIDKPTSGTVIFLNKLLNQLPEEQLAVIRGKHLGFIFQFFNLMPVLNVFDNVYFPLVLN
GQFSKKEATERTLHYLDSVGLSGFGDRKPGQLSGGQQQRVAIARALAHEPMVVIADEPTG
NLDLATGEAILDLLLTINQQTGTTFVISTHSSELKARARRVVEIQDGVLIHDSDA