Protein Info for MCAODC_23105 in Escherichia coli ECRC101

Name: solA
Annotation: N-methyl-L-tryptophan oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF01266: DAO" amino acids 4 to 352 (349 residues), 175.7 bits, see alignment E=2e-55 PF01593: Amino_oxidase" amino acids 157 to 204 (48 residues), 20.8 bits, see alignment 2.1e-08

Best Hits

Swiss-Prot: 100% identical to MTOX_ECO57: N-methyl-L-tryptophan oxidase (solA) from Escherichia coli O157:H7

KEGG orthology group: K02846, N-methyl-L-tryptophan oxidase [EC: 1.5.3.-] (inferred from 99% identity to eco:b1059)

MetaCyc: 99% identical to N-methyl-L-tryptophan oxidase (Escherichia coli K-12 substr. MG1655)
N-methyl-L-amino-acid oxidase. [EC: 1.5.3.2]

Predicted SEED Role

"N-methyl-L-amino-acid oxidase (EC 1.5.3.2); N-methyl-L-tryptophan oxidase (EC 1.5.3.-)" (EC 1.5.3.-, EC 1.5.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.3.- or 1.5.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>MCAODC_23105 N-methyl-L-tryptophan oxidase (Escherichia coli ECRC101)
MKYDLIIIGSGSVGAAAGYYATRAGLNVLMTDAHMPPHQHGSHHGDTRLIRHAYGEGEKY
VPLVLRAQTLWDDLSRHNEDDPIFVRSGVINLGPADSAFLANVAHSAEQWQLNVEKLDAQ
GIMARWPEIRVPDNYIGLFETDSGFLRSELAIKTWIQLAKEAGCAQLFNCPVTAIRHDDD
GVTIETADGEYQAKKAIVCAGTWVKDLLPELPVQPVRKVFAWYQADGRYSVKNKFPAFTG
ELPNGDQYYGFPAENDALKIGKHNGGQVIHSADERVPFAEVVSDGSEAFPFLRNVLPGIG
CCLYGAACTYDNSPDEDFIIDTLPGHDNTLLITGLSGHGFKFASVLGEIAADFAQDKKSD
FDLTPFSLSRFQ