Protein Info for MCAODC_22745 in Escherichia coli ECRC101

Name: eCs1768
Annotation: phage replisome organizer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details PF17948: DnaT" amino acids 201 to 267 (67 residues), 60.8 bits, see alignment E=4.2e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to etw:ECSP_1433)

Predicted SEED Role

"Primosomal protein I" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>MCAODC_22745 phage replisome organizer (Escherichia coli ECRC101)
MANAWLRLWHDMPNDPKWRTIARVSGQPIATVMAVYIHLLVSASRNVTKCHGESLRGHID
VTTEDLASALDVTEDVIDSILHAMQGRVLDGDLISGWEKRQVMKEDNGNVSQTAKSPAER
KRAQRERERLREQNTDCHDESRRVTHMSRQVTTDTDTDKELNPTHNARMRESAPASESNG
APLQTAEPEYPDGLSEPIGKFPMTGVWRPSLDFRQRAALWGMALPEPEFTPAELAAFRDY
WMAEGKVFTQVQWEQKFARHVQHVRAQVKPVSKGVSHAAPGGTASRAVQEIRAAREQWER
ENGFISNGNGLEAVGTYGGGVFEPLDPEERGCAVEALDCSDWRDD