Protein Info for MCAODC_22110 in Escherichia coli ECRC101

Annotation: Tail tube terminator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF06141: Phage_tail_U" amino acids 1 to 129 (129 residues), 207.5 bits, see alignment E=3.7e-66

Best Hits

Swiss-Prot: 100% identical to TTTP_LAMBD: Tail tube terminator protein (U) from Escherichia phage lambda

KEGG orthology group: None (inferred from 96% identity to ecz:ECS88_0580)

Predicted SEED Role

"Phage minor tail protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>MCAODC_22110 Tail tube terminator protein (Escherichia coli ECRC101)
MKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQA
ELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSS
ADLTYVITYEM