Protein Info for MCAODC_21955 in Escherichia coli ECRC101

Name: minC
Annotation: septum site-determining protein MinC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 TIGR01222: septum site-determining protein MinC" amino acids 6 to 230 (225 residues), 237.4 bits, see alignment E=8.2e-75 PF05209: MinC_N" amino acids 6 to 74 (69 residues), 66.6 bits, see alignment E=1.8e-22 PF03775: MinC_C" amino acids 128 to 227 (100 residues), 106.1 bits, see alignment E=8.9e-35

Best Hits

Swiss-Prot: 100% identical to MINC_ECO24: Probable septum site-determining protein MinC (minC) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 100% identity to eco:b1176)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>MCAODC_21955 septum site-determining protein MinC (Escherichia coli ECRC101)
MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVN
WSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTT
PVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGD
RETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN