Protein Info for MCAODC_21875 in Escherichia coli ECRC101

Name: dadX
Annotation: catabolic alanine racemase DadX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR00492: alanine racemase" amino acids 4 to 356 (353 residues), 470.4 bits, see alignment E=1.9e-145 PF01168: Ala_racemase_N" amino acids 10 to 217 (208 residues), 228.7 bits, see alignment E=7.4e-72 PF00842: Ala_racemase_C" amino acids 232 to 353 (122 residues), 138.7 bits, see alignment E=8.5e-45

Best Hits

Swiss-Prot: 100% identical to ALR2_ECO57: Alanine racemase, catabolic (dadX) from Escherichia coli O157:H7

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 99% identity to eco:b1190)

MetaCyc: 99% identical to alanine racemase 2 (Escherichia coli K-12 substr. MG1655)
Alanine racemase. [EC: 5.1.1.1, 5.1.1.10]

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.1

Use Curated BLAST to search for 5.1.1.1 or 5.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>MCAODC_21875 catabolic alanine racemase DadX (Escherichia coli ECRC101)
MTRPIQASLDLQALKQNLSIVRQAAPHARVWSVVKANAYGHGIERIWSALGATDGFALLN
LEEAITLRERGWKGPILMLEGFFHAQDLEMYDQHRLTTCVHSNWQLKALQNARLKAPLDI
YLKVNSGMNRLGFQPDRVLTVWQQLRAMANVGEMTLMSHFAEAEHPDGISGAMARIEQAA
EGLECRRSLSNSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTGLRPVMTLSSEII
GVQTLKAGERVGYGGRYTARDEQRIGIVAAGYADGYPRHAPTGTPVLVDGVRTMTVGTVS
MDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTVGYELMCALALRVPVVTV