Protein Info for MCAODC_21455 in Escherichia coli ECRC101

Name: rusA
Annotation: Endodeoxyribonuclease RusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF05866: RusA" amino acids 8 to 113 (106 residues), 54.8 bits, see alignment E=7.3e-19

Best Hits

Swiss-Prot: 60% identical to RUSA_BPHK7: Crossover junction endodeoxyribonuclease rusA (rusA) from Enterobacteria phage HK97

KEGG orthology group: None (inferred from 100% identity to ece:Z2057)

Predicted SEED Role

"Holliday junction resolvase / Crossover junction endodeoxyribonuclease rusA (EC 3.1.22.-)" (EC 3.1.22.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.22.-

Use Curated BLAST to search for 3.1.22.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>MCAODC_21455 Endodeoxyribonuclease RusA (Escherichia coli ECRC101)
MLIDLVLPYPPTVNTYWRRRGSTYFVSKAGERYRRAVVLIVRQQRLKLSLSGRLAIKIIA
EPPDKRRRDLDNILKAPLDALTHAGVLMDDEQFDEINIVRGQPVSGGRLGVKIYKIESE