Protein Info for MCAODC_20740 in Escherichia coli ECRC101

Name: mdtA
Annotation: multidrug efflux RND transporter subunit MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 62 to 390 (329 residues), 259 bits, see alignment E=2.7e-81 PF16576: HlyD_D23" amino acids 85 to 309 (225 residues), 44 bits, see alignment E=3.4e-15 PF13533: Biotin_lipoyl_2" amino acids 87 to 135 (49 residues), 58.4 bits, see alignment 9.2e-20 PF13437: HlyD_3" amino acids 198 to 300 (103 residues), 31.3 bits, see alignment E=6e-11

Best Hits

Swiss-Prot: 100% identical to MDTA_ECO57: Multidrug resistance protein MdtA (mdtA) from Escherichia coli O157:H7

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 99% identity to eco:b2074)

MetaCyc: 99% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>MCAODC_20740 multidrug efflux RND transporter subunit MdtA (Escherichia coli ECRC101)
MKGSYKSRWVIVIVVVIAAIAAFWFWQGRNDSQSAAPGATKQAQQSPAGGRRGMRSGPLA
PVQAATAVEQAVPRYLTGLGTITAANTVTVRSRVDGQLMALHFQEGQQVKAGDLLAEIDP
SQFKVALAQAQGQLAKDKATLTNARRDLARYQQLAKTNLVSRQELDAQQALVSETEGTIK
ADEASVASAQLQLDWSRITAPVDGRVGLKQVDVGNQISSGDTTGIVVITQTHPIDLLFTL
PESDIATVVQAQKAGKPLVVEAWDRTNSKKLSEGTLLSLDNQIDATTGTIKVKARFNNQD
DALFPNQFVNARMLVDTEQNAVVIPTAALQMGNEGHFVWVLNSENKVSKHLVTPGIQDSQ
KVVIRAGISAGDRVVTDGIDRLTEGAKVEVVEAQSATTPEEKATSREYAKKGARS