Protein Info for MCAODC_20620 in Escherichia coli ECRC101

Name: wcaB
Annotation: colanic acid biosynthesis acetyltransferase WcaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 40 to 58 (19 residues), see Phobius details TIGR04016: colanic acid biosynthesis acetyltransferase WcaB" amino acids 17 to 162 (146 residues), 317.8 bits, see alignment E=3.2e-100 PF00132: Hexapep" amino acids 109 to 141 (33 residues), 35.7 bits, see alignment 2.4e-13

Best Hits

Swiss-Prot: 100% identical to WCAB_ECO57: Putative colanic acid biosynthesis acetyltransferase WcaB (wcaB) from Escherichia coli O157:H7

KEGG orthology group: K03819, putative colanic acid biosynthesis acetyltransferase WcaB [EC: 2.3.1.-] (inferred from 100% identity to eco:b2058)

MetaCyc: 100% identical to colanic acid biosynthesis acetyltransferase WcaB (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Colanic acid biosynthesis acetyltransferase WcaB (EC 2.3.1.-)" in subsystem Colanic acid biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>MCAODC_20620 colanic acid biosynthesis acetyltransferase WcaB (Escherichia coli ECRC101)
MLEDLRANSWSLRPCCMVLAYRVAHFCSVWRKKNVLNNLWAAPLLVLYRIITECFFGYEI
QAAATIGRRFTIHHGYAVVINKNVVAGDDFTIRHGVTIGNRGADNMACPHIGNGVELGAN
VIILGDITLGNNVTVGAGSVVLDSVPDNALVVGEKARVKVIK