Protein Info for MCAODC_19825 in Escherichia coli ECRC101

Name: hprS
Annotation: two-component system sensor histidine kinase HprS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 159 to 180 (22 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 3 to 449 (447 residues), 317.2 bits, see alignment E=1e-98 PF00512: HisKA" amino acids 236 to 300 (65 residues), 42.9 bits, see alignment E=4.3e-15 PF02518: HATPase_c" amino acids 345 to 451 (107 residues), 64.3 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 99% identical to HPRS_ECOLI: Sensor histidine kinase HprS (hprS) from Escherichia coli (strain K12)

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 99% identity to eco:b1968)

MetaCyc: 99% identical to sensor histidine kinase HprS (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Putative two component system histidine kinase YedV" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>MCAODC_19825 two-component system sensor histidine kinase HprS (Escherichia coli ECRC101)
MKRLSITVRLTLLFILLLSVAGAGIVWTLYNGLASELKWRDDTTLINRTAQIKQLLIDGV
NPDTLPVYFNRMMDVSQDILIIHGDGINKIVNRTNVSDDMLNNIPASETISAAGIYRSII
NDTEIDALRINIDEVSPSLTVTVAKLASARHNMLEQYKINSIIICIVAIILCSVLSPLLI
RTGLREIKKLSGVTEALNYNDSREPVEVSALPRELKPLGQALNKMHHALVKDFERLSQFA
DDLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADK
NNVLVKLDSLSLNKEVENLLDYLEYLSDEKEICFKVECNQQIFADKILLQRMLSNLIVNA
IRYSPEKSRIHITSFLDTNSYLNIDIASPGAKINEPEKLFRRFWRGDNSRHSVGQGLGLS
LVKAIAELHGGSATYHYLNKHNVFRITLPQRN