Protein Info for MCAODC_18530 in Escherichia coli ECRC101

Name: ynjA
Annotation: Uncharacterized protein YnjA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details PF02627: CMD" amino acids 50 to 122 (73 residues), 32.6 bits, see alignment E=3.2e-12

Best Hits

Swiss-Prot: 99% identical to YNJA_ECOLI: Uncharacterized protein YnjA (ynjA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1753)

Predicted SEED Role

"FIG00922551: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>MCAODC_18530 Uncharacterized protein YnjA (Escherichia coli ECRC101)
MGLPPLSKIPFILRPQAWLHRRHYGEVLSPIRWWGRIPFIFYLVSMFVGWLERKRSPLDP
VVRSLVSARIAQMCLCEFCVDITSMKVAERTGSSDKLLAVADWRQSPLFSDEERLALEYA
EAASVTPPTVDDALRTRLAAHFDAQELTELTALIGLQNLSARFNSAMDIPAQGLCRIPEK
RS