Protein Info for MCAODC_17810 in Escherichia coli ECRC101

Name: hdhA
Annotation: 7-alpha-hydroxysteroid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00106: adh_short" amino acids 12 to 200 (189 residues), 201.6 bits, see alignment E=1.8e-63 PF08659: KR" amino acids 15 to 171 (157 residues), 33.2 bits, see alignment E=9.8e-12 PF13561: adh_short_C2" amino acids 18 to 249 (232 residues), 218.3 bits, see alignment E=2.4e-68

Best Hits

Swiss-Prot: 100% identical to HDHA_ECOLI: 7-alpha-hydroxysteroid dehydrogenase (hdhA) from Escherichia coli (strain K12)

KEGG orthology group: K00076, 7-alpha-hydroxysteroid dehydrogenase [EC: 1.1.1.159] (inferred from 100% identity to eco:b1619)

MetaCyc: 100% identical to 7-alpha-hydroxysteroid dehydrogenase (Escherichia coli K-12 substr. MG1655)
7-alpha-hydroxysteroid dehydrogenase. [EC: 1.1.1.159]

Predicted SEED Role

"7-alpha-hydroxysteroid dehydrogenase (EC 1.1.1.159)" (EC 1.1.1.159)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.159

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>MCAODC_17810 7-alpha-hydroxysteroid dehydrogenase (Escherichia coli ECRC101)
VFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGG
QAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVF
SFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEK
NIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVS
GQILTVSGGGVQELN