Protein Info for MCAODC_16890 in Escherichia coli ECRC101

Name: dgcZ
Annotation: diguanylate cyclase DgcZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 128 to 285 (158 residues), 131.3 bits, see alignment E=1.4e-42 PF00990: GGDEF" amino acids 130 to 283 (154 residues), 153 bits, see alignment E=3.2e-49

Best Hits

Swiss-Prot: 99% identical to DGCZ_ECOLI: Diguanylate cyclase DgcZ (dgcZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1535)

MetaCyc: 99% identical to diguanylate cyclase DgcZ (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"FIG00637874: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>MCAODC_16890 diguanylate cyclase DgcZ (Escherichia coli ECRC101)
MIKKTTEIDAILLNLNKAIDAHYQWLVSMFHSVVARDASKPEITDNHSYGLCQFGRWIDH
LRPLDNDELPYVRLMDSAHQHMHNCGRELMLAIVENHWQDAHFDAFQEGVLSFTAALTDY
KIYLLTIRSNMDVLTGLPGRRVLDESFDHQLRNTEPLNLYLMLLDIDRFKLVNDTYGHLI
GDVVLRTLATYLASWTRDYETVYRYGGEEFIIIVKAANDEEACRAGVRICQLVDNHAITH
SEGHINITVTAGVSRAFPEETLDVVIGRADRAMYEGKQTGRNRCMFIDEQNVINRV