Protein Info for MCAODC_16615 in Escherichia coli ECRC101

Name: ddpB
Annotation: putative D,D-dipeptide transport system permease protein DdpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 96 to 124 (29 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 305 to 330 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 7 to 78 (72 residues), 50.4 bits, see alignment E=2.4e-17 PF00528: BPD_transp_1" amino acids 115 to 335 (221 residues), 152.6 bits, see alignment E=1e-48

Best Hits

Swiss-Prot: 99% identical to DDPB_ECOLI: Probable D,D-dipeptide transport system permease protein DdpB (ddpB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 99% identity to eco:b1486)

MetaCyc: 46% identical to dipeptide ABC transporter membrane subunit DppB (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>MCAODC_16615 putative D,D-dipeptide transport system permease protein DdpB (Escherichia coli ECRC101)
VTFWSILRQRCWGLVLVVAGVCVITFIISHLIPGDPARLLAGDRASDAIVENIRQQLGLD
QPLYVQFYRYVSDLFHGDLGTSIRTGRPVLEELRIFFPATLELAFCALLLALLIGIPLGI
LSAVWRNRWLDHLVRIMAITGISTPAFWLGLGVIVLFYGHLQILPGGGRLDDWLDPPTHV
TGFYLLDALLEGNGEVFFNALQHLILPALTLAFVHLGIVARQIRSAMLEQLSEDYIRTAR
ASGLPGWYIVLCYALPNALIPSITVLGLALGDLLYGAVLTETVFAWPGMGAWVVTSIQAL
DFPAVMGFAVVVSFAYVLVNLVVDLLYLWIDPRIGRGGGE