Protein Info for MCAODC_16315 in Escherichia coli ECRC101

Name: tehB
Annotation: tellurite resistance methyltransferase TehB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00477: tellurite resistance protein TehB" amino acids 1 to 196 (196 residues), 375.5 bits, see alignment E=4.4e-117 PF03848: TehB" amino acids 1 to 193 (193 residues), 365.7 bits, see alignment E=1.6e-113 PF05175: MTS" amino acids 23 to 102 (80 residues), 32 bits, see alignment E=3.4e-11 PF13489: Methyltransf_23" amino acids 29 to 166 (138 residues), 42.8 bits, see alignment E=1.7e-14 PF13847: Methyltransf_31" amino acids 33 to 133 (101 residues), 33.2 bits, see alignment E=1.4e-11 PF13649: Methyltransf_25" amino acids 35 to 128 (94 residues), 52.9 bits, see alignment E=1.7e-17 PF08242: Methyltransf_12" amino acids 35 to 128 (94 residues), 41.1 bits, see alignment E=8.8e-14 PF08241: Methyltransf_11" amino acids 35 to 130 (96 residues), 48.3 bits, see alignment E=4.6e-16

Best Hits

Swiss-Prot: 98% identical to TEHB_ECOLI: Tellurite methyltransferase (tehB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b1430)

MetaCyc: 98% identical to tellurite methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6576 [EC: 2.1.1.265]

Predicted SEED Role

"Tellurite resistance protein TehB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.265

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>MCAODC_16315 tellurite resistance methyltransferase TehB (Escherichia coli ECRC101)
MIIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDK
NAMSIANVERIKSIENLDNLHTRVVDLNNLTFDGEYDFILSTVVLMFLEAKTIPGLIANM
QRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWEMVKYNEDVGELHRTDA
NGNRIKLRFATMLARKK