Protein Info for MCAODC_16180 in Escherichia coli ECRC101

Name: ynbA
Annotation: Inner membrane protein YnbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01066: CDP-OH_P_transf
  • amino acids 27 to 174 (148 residues), 38.1 bits, E=1.1e-13

Best Hits

Swiss-Prot: 98% identical to YNBA_ECOLI: Inner membrane protein YnbA (ynbA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b1408)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (12/12 steps found)
• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (11/13 steps found)
• cardiolipin biosynthesis I (3/3 steps found)
• cardiolipin biosynthesis II (3/3 steps found)
• cardiolipin biosynthesis III (3/3 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Protein Sequence (201 amino acids)

>MCAODC_16180 Inner membrane protein YnbA (Escherichia coli ECRC101)
MTLYQIKPLFQSLLRPTMFWLYKHHVTANHITLAALALSLITGLLLMLVAQPILFLLLPI
VLFIRMALNALDGMLARECNQQTRLGAILNETGDVISDIALYLPFLFLPESNASLVILML
FCTILTEFCGLLAQTINGIRSYVGPFGKSDRALIFGLWGLAVAIYPQWMQWNNLLWSIAS
ILLLWTAINRCRSVLLMSAER