Protein Info for MCAODC_15895 in Escherichia coli ECRC101

Name: ycjN
Annotation: Putative ABC transporter periplasmic-binding protein YcjN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01547: SBP_bac_1" amino acids 40 to 206 (167 residues), 90.7 bits, see alignment E=1.8e-29 PF13416: SBP_bac_8" amino acids 48 to 195 (148 residues), 56.9 bits, see alignment E=2.9e-19

Best Hits

Predicted SEED Role

"ABC-type sugar transport system, periplasmic binding protein YcjN" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>MCAODC_15895 Putative ABC transporter periplasmic-binding protein YcjN (Escherichia coli ECRC101)
MIKSKIVLLSALVSCALISGCKEENKPHVSIEFMHSSVEQERQAVISKLIARFEKENPGI
TVKQVPVEEDAYNTKVITLSRSGSLPEVIETSHDYAKVMDKEQLIDRKAVATVISNVGEG
AFYDGVLRIVRTEDGSAWTGVPVSAWIGGIWYRKDVLAKAGLEEPKNWQQLLDVAQKLND
PANKKYGIALPTAESVLTEQSFSQFALSN