Protein Info for MCAODC_15280 in Escherichia coli ECRC101

Name: gspG
Annotation: type II secretion system major pseudopilin GspG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF07963: N_methyl" amino acids 5 to 28 (24 residues), 37.5 bits, see alignment 1.2e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 6 to 28 (23 residues), 34.9 bits, see alignment 9.2e-13 TIGR01710: type II secretion system protein G" amino acids 7 to 137 (131 residues), 184.9 bits, see alignment E=6.3e-59 PF08334: T2SSG" amino acids 31 to 137 (107 residues), 121.5 bits, see alignment E=1.7e-39

Best Hits

Swiss-Prot: 84% identical to GSPG_PECCC: Type II secretion system protein G (outG) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 100% identity to etw:ECSP_6006)

MetaCyc: 69% identical to type II secretion system protein GspG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>MCAODC_15280 type II secretion system major pseudopilin GspG (Escherichia coli ECRC101)
MRKQHQRGFTLLEIMVVIVILGVLASLVVPNLMGNKDKADRQKVMSDLVALESTLDMYRL
DNNRYPTTEQGLRALVSKPTVQPEPRNYRQDGYIRRLPQDPWGGDYQLLNPGQYSDIDIF
SPGPDGVPNTEDDIGNWTLGNAQP