Protein Info for MCAODC_15255 in Escherichia coli ECRC101

Name: stcE
Annotation: metalloprotease StcE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 886 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF20944: StcE_b-sandwich" amino acids 166 to 232 (67 residues), 63.1 bits, see alignment 4.1e-21 amino acids 590 to 656 (67 residues), 43.9 bits, see alignment 4.2e-15 PF10462: Peptidase_M66" amino acids 237 to 537 (301 residues), 280.8 bits, see alignment E=2.3e-87 PF12561: TagA" amino acids 667 to 762 (96 residues), 121.8 bits, see alignment E=3e-39 PF17945: Crystall_4" amino acids 795 to 884 (90 residues), 127.7 bits, see alignment E=3.7e-41

Best Hits

Swiss-Prot: 100% identical to STCE_ECO57: Metalloprotease StcE (stcE) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to ecs:pO157p01)

Predicted SEED Role

"Lipoprotein, ToxR-activated gene, TagA" in subsystem Vibrio pathogenicity island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (886 amino acids)

>MCAODC_15255 metalloprotease StcE (Escherichia coli ECRC101)
MKLKYLSCTILAPLAIGVFSATAADNNSAIYFNTSQPINDLQGSLAAEVKFAQSQILPAH
PKEGDSQPHLTSLRKSLLLVRPVKADDKTPVQVEARDDNNKILGTLTLYPPSSLPDTIYH
LDGVPEGGIDFTPHNGTKKIINTVAEVNKLSDASGSSIHSHLTNNALVEIHTANGRWVRD
IYLPQGPDLEGKMVRFVSSAGYSSTVFYGDRKVTLSVGNTLLFKYVNGQWFRSGELENNR
ITYAQHIWSAELPAHWIVPGLNLVIKQGNLSGRLNDIKIGAPGELLLHTIDIGMLTTPRD
RFDFAKDKEAHREYFQTIPVSRMIVNNYAPLHLKEVMLPTGELLTDMDPGNGGWHSGTMR
QRIGKELVSHGIDNANYGLNSTAGLGENSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGG
IVTLDSTLGNEFSHEVGHNYGLGHYVDGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPS
QTNEKSCLNNQCQEPFDGHKFGFDAMAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVFD
SRSSTGFSKWNADTQEMEPYEHTIDRAEQITASVNELSESKMAELMAEYAVVKVHMWNGN
WTRNIYIPTASADNRGSILTINHEAGYNSYLFINGDEKVVSQGYKKSFVSDGQFWKERDV
VDTREARKPEQFGVPVTTLVGYYDPEGTLSSYIYPAMYGAYGFTYSDDSQNLSDNDCQLQ
VDTKEGQLRFRLANHRANNTVMNKFHINVPTESQPTQATLVCNNKILDTKSLTPAPEGLT
YTVNGQALPAKENEGCIVSVNSGKRYCLPVGQRSGYSLPDWIVGQEVYVDSGAKAKVLLS
DWDNLSYNRIGEFVGNVNPADMKKVKAWNGQYLDFSKPRSMRVVYK