Protein Info for MCAODC_12545 in Escherichia coli ECRC101

Name: eutP
Annotation: ethanolamine utilization acetate kinase EutP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF10662: PduV-EutP" amino acids 1 to 143 (143 residues), 103.4 bits, see alignment E=9.2e-34 TIGR02528: ethanolamine utilization protein, EutP" amino acids 2 to 144 (143 residues), 196 bits, see alignment E=1.6e-62

Best Hits

Swiss-Prot: 98% identical to EUTP_ECOLI: Ethanolamine utilization protein EutP (eutP) from Escherichia coli (strain K12)

KEGG orthology group: K04029, ethanolamine utilization protein EutP (inferred from 98% identity to eco:b2461)

MetaCyc: 86% identical to acetate kinase EutP (Salmonella enterica enterica serovar Typhimurium str. LT2)
Acetate kinase. [EC: 2.7.2.1, 2.7.2.15]

Predicted SEED Role

"Ethanolamine utilization protein EutP" in subsystem Ethanolamine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.1, 2.7.2.15

Use Curated BLAST to search for 2.7.2.1 or 2.7.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>MCAODC_12545 ethanolamine utilization acetate kinase EutP (Escherichia coli ECRC101)
MKRIAFVGTVGAGKTTLFNALQGNYTLARKTQAVEFNDKGDIDTPGEYFSHPRWYHALIT
TLQDVDMLIYVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGF
EEPIFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE