Protein Info for MCAODC_12130 in Escherichia coli ECRC101

Name: yhfR
Annotation: Uncharacterized protein YfhR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details PF12146: Hydrolase_4" amino acids 77 to 187 (111 residues), 48.8 bits, see alignment E=1.8e-16 PF00561: Abhydrolase_1" amino acids 81 to 191 (111 residues), 45.3 bits, see alignment E=2.6e-15 PF12697: Abhydrolase_6" amino acids 81 to 182 (102 residues), 31.2 bits, see alignment E=1.1e-10 PF00326: Peptidase_S9" amino acids 99 to 281 (183 residues), 32 bits, see alignment E=2.8e-11 PF03959: FSH1" amino acids 173 to 256 (84 residues), 21.3 bits, see alignment E=5.7e-08

Best Hits

Swiss-Prot: 100% identical to YHFR_ECO57: Uncharacterized protein YfhR (yhfR) from Escherichia coli O157:H7

KEGG orthology group: K06889, (no description) (inferred from 99% identity to eco:b2534)

Predicted SEED Role

"Uncharacterized protein yfhR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>MCAODC_12130 Uncharacterized protein YfhR (Escherichia coli ECRC101)
MALPVNKRVPKILFILFVVAFCVYLVPRVAINFFYYPDDKIYGPDPWSAESVEFTAKDGT
RLQGWFIPSSTGPADNAIATIIHAHGNAGNMSAHWPLVSWLPERNFNVFMFDYRGFGKSK
GTPSQAGLLDDTQSAINVVRHRSDVNPQRLVLFGQSIGGANILAVIGQGDREGIRAVILD
STFASYATIANQMIPGSGYLLDESYSGENYIASVSPIPLLLIHGKADHVIPWQHSEKLYS
LAKEPKRLILIPDGEHIDAFSDRHGDVYREQMVNFILSALNPQN