Protein Info for MCAODC_11370 in Escherichia coli ECRC101

Name: yciW
Annotation: alkylhydroperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF02627: CMD" amino acids 13 to 94 (82 residues), 74.5 bits, see alignment E=2.7e-25 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 30 to 77 (48 residues), 54.7 bits, see alignment E=2.8e-19

Best Hits

Swiss-Prot: 34% identical to YDFG_BACSU: Uncharacterized protein YdfG (ydfG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 99% identity to ecc:c3225)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase domain/alkylhydroperoxidase AhpD family core domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>MCAODC_11370 alkylhydroperoxidase (Escherichia coli ECRC101)
MTTLRQPYYELSPAVYNALVQAKTALENSTLDTTLMELIYLRVSQINGCAFCLEMHSKAL
RKSGVPQHKLDALAGWRVSHHFDERERAALAWAESVTDIARTHAEDEVYQPLLEHFSAAE
ISDLTFAIGLMNCFNRLAVSMRM