Protein Info for MCAODC_10975 in Escherichia coli ECRC101
Name: cysC
Annotation: Adenylyl-sulfate kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CYSC_SHISS: Adenylyl-sulfate kinase (cysC) from Shigella sonnei (strain Ss046)
KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 100% identity to eco:b2750)MetaCyc: 100% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]
Predicted SEED Role
"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)
MetaCyc Pathways
- superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
- assimilatory sulfate reduction I (4/4 steps found)
- sulfate activation for sulfonation (2/2 steps found)
- assimilatory sulfate reduction IV (3/4 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.25
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (201 amino acids)
>MCAODC_10975 Adenylyl-sulfate kinase (Escherichia coli ECRC101) MALHDENVVWHSHPVTVQQRELHHGHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTY LLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRE RVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQ LVTNLVQQLLDLLRQNDIIRS