Protein Info for MCAODC_10205 in Escherichia coli ECRC101

Name: ygeY
Annotation: YgeY family selenium metabolism-linked hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 TIGR03526: putative selenium metabolism hydrolase" amino acids 8 to 400 (393 residues), 721.5 bits, see alignment E=1.2e-221 PF01546: Peptidase_M20" amino acids 78 to 395 (318 residues), 73.9 bits, see alignment E=1.7e-24 PF07687: M20_dimer" amino acids 183 to 282 (100 residues), 60.1 bits, see alignment E=1.9e-20

Best Hits

Swiss-Prot: 100% identical to YGEY_ECOLI: Uncharacterized protein YgeY (ygeY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2872)

Predicted SEED Role

"Putative deacetylase YgeY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>MCAODC_10205 YgeY family selenium metabolism-linked hydrolase (Escherichia coli ECRC101)
MAKNIPFKLILEKAKDYQADMTRFLRDMVAIPSESCDEKRVVHRIKEEMEKVGFDKVEID
PMGNVLGYIGHGPRLVAMDAHIDTVGIGNIKNWDFDPYEGMETDELIGGRGTSDQEGGMA
SMVYAGKIIKDLGLEDEYTLLVTGTVQEEDCDGLCWQYIIEQSGIRPEFVVSTEPTDCQV
YRGQRGRMEIRIDVQGVSCHGSAPERGDNAIFKMGPILGELQELSQRLGYDEFLGKGTLT
VSEIFFTSPSRCAVADSCAVSIDRRLTWGETWEGALDEIRALPAVQKANAVVSMYNYDRP
SWTGLVYPTECYFPTWKVEEDHFTVKALVNAYEGLFGKAPVVDKWTFSTNGVSIMGRHGI
PVIGFGPGKEPEAHAPNEKTWKSHLVTCAAMYAAIPLSWLATE