Protein Info for MCAODC_09550 in Escherichia coli ECRC101

Name: hypA
Annotation: hydrogenase maturation nickel metallochaperone HypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00100: hydrogenase nickel insertion protein HypA
  • amino acids 1 to 113 (113 residues), 148.1 bits, E=5.1e-48
• PF01155: HypA
  • amino acids 1 to 112 (112 residues), 113.5 bits, E=2.6e-37

Best Hits

Swiss-Prot: 100% identical to HYBF_ECO57: Hydrogenase maturation factor HybF (hybF) from Escherichia coli O157:H7

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 99% identity to eco:b2991)

MetaCyc: 48% identical to hydrogenase 3 nickel incorporation protein HypA (Escherichia coli K-12 substr. MG1655)
RXN-22650

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HybF" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (9/10 steps found)

Protein Sequence (113 amino acids)

>MCAODC_09550 hydrogenase maturation nickel metallochaperone HypA (Escherichia coli ECRC101)
MHELSLCQSAVEIIQRQAEQHDVKRVTAVWLEIGALSCVEESAVRFSFEIVCHGTVAQGC
DLHIVYKPAQAWCWDCSQVVEVHQHDAQCPLCHGERLRVDTGDSLIVKSIEVE