Protein Info for MCAODC_09400 in Escherichia coli ECRC101

Name: ygiW
Annotation: OB fold stress tolerance protein YgiW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00156: TIGR00156 family protein" amino acids 2 to 129 (128 residues), 219.7 bits, see alignment E=5e-70 PF04076: BOF" amino acids 25 to 127 (103 residues), 160.9 bits, see alignment E=4e-52

Best Hits

Swiss-Prot: 100% identical to YGIW_ECOLI: Protein YgiW (ygiW) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3024)

Predicted SEED Role

"Protein ygiW precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>MCAODC_09400 OB fold stress tolerance protein YgiW (Escherichia coli ECRC101)
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTW
VTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEI
DVKQIRKVNP