Protein Info for MCAODC_08475 in Escherichia coli ECRC101

Name: lptC
Annotation: LPS export ABC transporter periplasmic protein LptC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04409: LPS export ABC transporter periplasmic protein LptC
  • amino acids 6 to 182 (177 residues), 176.5 bits, E=1.9e-56
• PF06835: LptC
  • amino acids 10 to 183 (174 residues), 184.2 bits, E=8.8e-59

Best Hits

Swiss-Prot: 100% identical to LPTC_SHIFL: Lipopolysaccharide export system protein LptC (lptC) from Shigella flexneri

KEGG orthology group: K11719, lipopolysaccharide export system protein LptC (inferred from 100% identity to eco:b3199)

MetaCyc: 100% identical to lipopolysaccharide transport system protein LptC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"Uncharacterized protein YrbK clustered with lipopolysaccharide transporters"

MetaCyc Pathways

• Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Protein Sequence (191 amino acids)

>MCAODC_08475 LPS export ABC transporter periplasmic protein LptC (Escherichia coli ECRC101)
MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSY
RLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNAL
VPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRT
SYEIQNKQTQP