Protein Info for MCAODC_08390 in Escherichia coli ECRC101

Name: nanQ
Annotation: N-acetylneuraminate anomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04074: DUF386
  • amino acids 1 to 149 (149 residues), 140.9 bits, E=1.6e-45
• TIGR00022: YhcH/YjgK/YiaL family protein
  • amino acids 1 to 153 (153 residues), 220.9 bits, E=3.4e-70

Best Hits

Swiss-Prot: 96% identical to YHCH_ECOLI: Uncharacterized protein YhcH (yhcH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to eoi:ECO111_4041)

MetaCyc: 96% identical to N-acetylneuraminate anomerase (Escherichia coli K-12 substr. MG1655)
RXN0-7389 [EC: 5.1.3.24]

Predicted SEED Role

"Putative sugar isomerase involved in processing of exogenous sialic acid" in subsystem Sialic Acid Metabolism

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (6/6 steps found)
• N-acetylneuraminate and N-acetylmannosamine degradation I (4/4 steps found)
• N-acetylneuraminate and N-acetylmannosamine degradation II (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.24

Protein Sequence (154 amino acids)

>MCAODC_08390 N-acetylneuraminate anomerase (Escherichia coli ECRC101)
MMMGEVQSLPSAGLHPALQDALTLALAARPQEKAPGRYELQGDNIFMNVMTFNTQSPVEK
KAELHEQYIDIQLLLKGEERILFGTAGTARQCEEFHHEDDYQLCSAIENEQTINLKPGMF
AVFMPGEPHKPGCVVGEPGEIKKVVVKVKADLMA