Protein Info for MCAODC_08390 in Escherichia coli ECRC101
Name: nanQ
Annotation: N-acetylneuraminate anomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 96% identical to YHCH_ECOLI: Uncharacterized protein YhcH (yhcH) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 96% identity to eoi:ECO111_4041)MetaCyc: 96% identical to N-acetylneuraminate anomerase (Escherichia coli K-12 substr. MG1655)
RXN0-7389 [EC: 5.1.3.24]
Predicted SEED Role
"Putative sugar isomerase involved in processing of exogenous sialic acid" in subsystem Sialic Acid Metabolism
MetaCyc Pathways
- superpathway of N-acetylneuraminate degradation (22/22 steps found)
- superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (6/6 steps found)
- N-acetylneuraminate and N-acetylmannosamine degradation I (4/4 steps found)
- N-acetylneuraminate and N-acetylmannosamine degradation II (1/3 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.1.3.24
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (154 amino acids)
>MCAODC_08390 N-acetylneuraminate anomerase (Escherichia coli ECRC101) MMMGEVQSLPSAGLHPALQDALTLALAARPQEKAPGRYELQGDNIFMNVMTFNTQSPVEK KAELHEQYIDIQLLLKGEERILFGTAGTARQCEEFHHEDDYQLCSAIENEQTINLKPGMF AVFMPGEPHKPGCVVGEPGEIKKVVVKVKADLMA