Protein Info for MCAODC_08350 in Escherichia coli ECRC101

Name: sspA
Annotation: stringent starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF02798: GST_N" amino acids 10 to 81 (72 residues), 75.5 bits, see alignment E=8.5e-25 PF13417: GST_N_3" amino acids 21 to 87 (67 residues), 54.1 bits, see alignment E=4.1e-18 PF13409: GST_N_2" amino acids 21 to 82 (62 residues), 63.3 bits, see alignment E=6.3e-21 PF00043: GST_C" amino acids 102 to 194 (93 residues), 57.2 bits, see alignment E=4.1e-19 PF13410: GST_C_2" amino acids 125 to 170 (46 residues), 31.9 bits, see alignment 2.9e-11

Best Hits

Swiss-Prot: 100% identical to SSPA_ECOLI: Stringent starvation protein A (sspA) from Escherichia coli (strain K12)

KEGG orthology group: K03599, RNA polymerase-associated protein (inferred from 100% identity to eco:b3229)

Predicted SEED Role

"Stringent starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>MCAODC_08350 stringent starvation protein A (Escherichia coli ECRC101)
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVP
TLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYTLMNTIING
SASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDCYLAPLLWRLPQLGIEFSGPGA
KELKGYMTRVFERDSFLASLTEAEREMRLGRS