Protein Info for MCAODC_07625 in Escherichia coli ECRC101

Name: hofO
Annotation: DNA utilization protein HofO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details

Best Hits

Swiss-Prot: 96% identical to HOFO_ECOLI: DNA utilization protein HofO (hofO) from Escherichia coli (strain K12)

KEGG orthology group: K12290, pilus assembly protein HofO (inferred from 100% identity to etw:ECSP_4342)

Predicted SEED Role

"Type IV pilus biogenesis protein PilO" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>MCAODC_07625 DNA utilization protein HofO (Escherichia coli ECRC101)
MNMFFDWWFATSPRLRQFCWAFWLLMLVTLIFLSSTHHEERDALIRLRASHHQHWATLYR
LVDTTPFSEEKTLPFSPLDFQLPGAQLVFWHPSAQGGELALKTLWEAVPSAFTRLAERNV
SVSRFSLSVEGDDLLFTLQLETPHEG