Protein Info for MCAODC_07600 in Escherichia coli ECRC101

Name: igaA
Annotation: intracellular growth attenuator protein IgaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 60 to 78 (19 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 648 to 670 (23 residues), see Phobius details PF07095: IgaA" amino acids 1 to 699 (699 residues), 1194 bits, see alignment E=0

Best Hits

Swiss-Prot: 100% identical to IGAA_ECO57: Putative membrane protein IgaA homolog (yrfF) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b3398)

Predicted SEED Role

"IgaA: a membrane protein that prevents overactivation of the Rcs regulatory system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (707 amino acids)

>MCAODC_07600 intracellular growth attenuator protein IgaA (Escherichia coli ECRC101)
VIFLAALLACSLLAGWLIKVRSRRRQLPWTNAFADAQTRKLTPEERSAVENYLESLTQVL
QVPGPTGASAAPISLALNAESNNVMMLTHAITRYGISTDDPNKWRYYLDSVEVHLPPFWE
QYINDENTVELIHTDSLPLVISLNGHTLQEYMQETRGYALQPVPSTQASIRGEESEQIEL
LNIRKETHEEYALSRPRGLREALLIVASFLMFFFCLITPDVFVPWLAGGALLLLGAGLWG
LFAPPAKSSLREIHCLRGTPRRWGLFGENDQEQINNISLGIIDLVYPAHWQPYIAQDLGQ
QTDIDIYLDRHLVRQGRYLSLHDEVKNFPLQHWLRSTIIAAGSLLVLFMLLFWIPLDMPL
KFTLSWMKGAQTIEATSVKQLADAGVRVGDTLRISGTGMCNIRTSGTWSAKTNSPFLPFD
CSQIIWNDARSLPLPESELVNKATALTEAVNRQLHPKPEDESRVSASLRSAIQKSGMVLL
DDFGDIVLKTADLCSAKDDCVRLKNALVNLGNSKDWDALVKRANAGKLDGVNVLLRPVSA
ESLDNLVATSTAPFITHETARAAQSLNSPAPGGFLIVSDEGSDFVDQPWPSASLYDYPPQ
EQWNAFQKLAQMLMHTPFNAEGIVTKIFTDANGTQHIGLHPIPDRSGLWRYLSTTLLLLT
MLGSAIYNGVQAWRRYQRHRTRMMKIQAYYESCLNPQLITPSESLIE