Protein Info for MCAODC_07425 in Escherichia coli ECRC101

Name: glgC
Annotation: glucose-1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 21 to 397 (377 residues), 520.8 bits, see alignment E=9.4e-161 PF00483: NTP_transferase" amino acids 22 to 291 (270 residues), 230.2 bits, see alignment E=4.3e-72 PF24894: Hexapep_GlmU" amino acids 314 to 417 (104 residues), 140.8 bits, see alignment E=2.4e-45

Best Hits

Swiss-Prot: 100% identical to GLGC_ECOL5: Glucose-1-phosphate adenylyltransferase (glgC) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 100% identity to eco:b3430)

MetaCyc: 100% identical to glucose-1-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate adenylyltransferase. [EC: 2.7.7.27]

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>MCAODC_07425 glucose-1-phosphate adenylyltransferase (Escherichia coli ECRC101)
MVSLEKNDHLMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSN
CINSGIRRMGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLLPAQQRMKGENWYRGTADA
VTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIEEASAFGV
MAVDENDKIIEFVEKPANPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDF
GKDLIPKITEAGLAYAHPFPLSCVQSDPDAEPYWRDVGTLEAYWKANLDLASVVPELDMY
DRNWPIRTYNESLPPAKFVQDRSGSHGMTLNSLVSGGCVISGSVVVQSVLFSRVRVNSFC
NIDSAVLLPEVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARRFYRSEEGIVLVTRE
MLRKLGHKQER