Protein Info for MCAODC_06865 in Escherichia coli ECRC101

Name: chuA
Annotation: TonB-dependent heme/hemoglobin receptor ChuA/ShuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 30 to 660 (631 residues), 450.8 bits, see alignment E=9e-139 TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 30 to 660 (631 residues), 588.5 bits, see alignment E=1.9e-180 PF07715: Plug" amino acids 45 to 147 (103 residues), 95.6 bits, see alignment E=2.6e-31 PF00593: TonB_dep_Rec" amino acids 230 to 624 (395 residues), 146.3 bits, see alignment E=2.6e-46

Best Hits

Swiss-Prot: 71% identical to HMUR_YERPE: Hemin receptor (hmuR) from Yersinia pestis

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ecg:E2348C_3743)

Predicted SEED Role

"TonB-dependent hemin , ferrichrome receptor" in subsystem Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (660 amino acids)

>MCAODC_06865 TonB-dependent heme/hemoglobin receptor ChuA/ShuA (Escherichia coli ECRC101)
MSRPQFTSLRLSLLALAVSATLPTFAFATETMTVTATGNARSSFEAPMMVSVIDTSAPEN
QTATSATDLLRHVPGITLDGTGRTNGQDVNMRGYDHRGVLVLVDGVRQGTDTGHLNGTFL
DPALIKRVEIVRGPSALLYGSGALGGVISYDTVDAKDLLQEGQSSGFRVFGTGGTGDHSL
GLGASAFGRTENLDGIVAWSSRDRGDLRQSNGETAPNDESINNMLAKGTWQIDSAQSLSG
LVRYYNNDAREPKNPQTVEASESSNPMVDRSTIQRDAQLSYKLAPQGNDWLNADAKIYWS
EVRINAQNTGSSGEYREQITKGARLENRSTLFADSFASHLLTYGGEYYRQEQHPGGATTG
FPQAKIDFSSGWLQDEITLRDLPITLLGGTRYDSYRGSSDGYKDVDADKWSSRAGMTINP
TNWLMLFGSYAQAFRAPTMGEMYNDSKHFSIGRFYTNYWVPNPNLRPETNETQEYGFGLR
FDDLMLSNDALEFKASYFDTKAKDYISTTVDFAAATTMSYNVPNAKIWGWDVMTKYTTDL
FSLDVAYNRTRGKDTDTGEYISSINPDTVTSTLNIPIAHSGFSVGWVGTFADRSTHISSS
YSKQPGYGVNDFYVSYQGQQALKGMTTTLVLGNAFDKEYWSPQGIPQDGRNGKIFVSYQW