Protein Info for MCAODC_06740 in Escherichia coli ECRC101

Name: yhjD
Annotation: inner membrane protein YhjD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 71 to 97 (27 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 296 to 321 (26 residues), see Phobius details TIGR00766: inner membrane protein YhjD" amino acids 52 to 326 (275 residues), 452 bits, see alignment E=3e-140 PF03631: Virul_fac_BrkB" amino acids 66 to 325 (260 residues), 166.6 bits, see alignment E=4.3e-53

Best Hits

Swiss-Prot: 99% identical to YHJD_ECOLI: Inner membrane protein YhjD (yhjD) from Escherichia coli (strain K12)

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to eum:ECUMN_4023)

Predicted SEED Role

"Inner membrane protein YhjD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>MCAODC_06740 inner membrane protein YhjD (Escherichia coli ECRC101)
MTQENEIKRPTQDLEHEPIKQLDNSEKGGKVSQALETVTTTAEKVQRQPVIAHLIRATER
FNDRLGNQFGAAITYFSFLSMIPILMVSFAAGGFVLASHPMLLQDIFDKILQNISDPTLA
ATLKNTINTAVQQRTTVGLVGLAVALYSGINWMGNLREAIRAQSRDVWERSPQDQEKFWV
KYLRDFISLIGLLIALIVTLSITSVAGSAQQMIISALHLNSIEWLKPTWRLIGLAISIFA
NYLLFFWIFWRLPRHRPRKKALIRGTFLAAIGFEVIKIVMTYTLPSLMKSPSGAAFGSVL
GLMAFFYFFARLTLFCAAWIATAEYKDDPRMPGKTQP