Protein Info for MCAODC_05870 in Escherichia coli ECRC101

Name: escV
Annotation: type III secretion system LEE export apparatus protein EscV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 104 to 130 (27 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 233 to 258 (26 residues), see Phobius details amino acids 287 to 319 (33 residues), see Phobius details TIGR01399: type III secretion protein, HrcV family" amino acids 14 to 670 (657 residues), 942.1 bits, see alignment E=9.5e-288 PF00771: FHIPEP" amino acids 27 to 662 (636 residues), 672 bits, see alignment E=5.2e-206

Best Hits

KEGG orthology group: K03230, type III secretion protein SctV (inferred from 100% identity to etw:ECSP_4684)

Predicted SEED Role

"Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (675 amino acids)

>MCAODC_05870 type III secretion system LEE export apparatus protein EscV (Escherichia coli ECRC101)
MNKLLNIFKKAESYHDLILALFFFMAVMMMIIPLPTVVVDIIIAINISTALLLLMLSIYI
KNPLELTSFPTILLITTLMRLSLSVSTTRLILLHHDAGDIIYSFGNFVVGGNIVVGLVIF
TIITIVQFMVITKGAERVAEVSARFSLDGMPGKQMSIDGDMRAGVIDPLEAKVLRSRVQK
ESQFYGSMDGAMKFVKGDAIAGIIIVLVNLFGGVLIGMWQFDMPFSAALSLFSVLSVGDA
LVAQIPALIISVTAGVVVTRVPGESEKEENLAGDIVQQVSVNSRPFLISAALMLVMAIIP
GFPALVFLFLAVCLLGIAWKLQKKRTFGTGNNKDAMGADLSNSQNISPGAEPLILNLSSN
IYSSDITQQIEVMRWNFFEESGIPLPKIIVNPVKNNDSAIEFLLYQESIYKDTLIDDTVY
FEAGHAEISFEFVQEKLSTNSIVYKTNKTNQQLAHLTGMDVYATTNDKITFLLKKLVLSN
AKEFIGVQETRYLMDIMERKYNELVKELQRQLGLSKIVDILQRLVEENVSIRDLRTIFET
LIFWSTKEKDVVILCEYVRIALRRHILGRYSVSGTLLNVWLIGSDIENELRESIRQTSSG
SYLNISPERTEQIIGFLKNIMNPTGNGVILTALDIRRYVKKMIEGSFPSVPVLSFQEVGN
NIELKVLGTVNDFRA