Protein Info for MCAODC_05695 in Escherichia coli ECRC101

Name: uhpB
Annotation: signal transduction histidine-protein kinase/phosphatase UhpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 71 to 75 (5 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 186 to 203 (18 residues), see Phobius details amino acids 215 to 244 (30 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details PF05231: MASE1" amino acids 12 to 275 (264 residues), 57 bits, see alignment E=2.8e-19 PF07730: HisKA_3" amino acids 305 to 370 (66 residues), 55 bits, see alignment E=1.4e-18 PF02518: HATPase_c" amino acids 411 to 497 (87 residues), 43.9 bits, see alignment E=4.5e-15

Best Hits

Swiss-Prot: 99% identical to UHPB_ECOLI: Signal transduction histidine-protein kinase/phosphatase UhpB (uhpB) from Escherichia coli (strain K12)

KEGG orthology group: K07675, two-component system, NarL family, sensor histidine kinase UhpB [EC: 2.7.13.3] (inferred from 99% identity to eco:b3668)

MetaCyc: 99% identical to sensor histidine kinase UhpB (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor histidine protein kinase UhpB, glucose-6-phosphate specific (EC 2.7.13.3)" in subsystem Hexose Phosphate Uptake System (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>MCAODC_05695 signal transduction histidine-protein kinase/phosphatase UhpB (Escherichia coli ECRC101)
MKTLFSRLITVIACFFIFSAAWFCLWSISLHLVERPDMAVLLFPFGLRLGLMLQCPRGYW
PVLLGAEWLLIYWLTQAVGLTHFSLLMIGSLLTLLPVALISRYRHQRDWRTLLLQGAALT
AAALLQSLPWLWHGKESWNALLLTLTGGLTLAPICLVFWHYLANNTWLPLGPSLVSQPIN
WRGRHLVWYLLLFVISLWLQLGLPDELSRFTPFCLALPIIALAWHYGWQGALIATLMNAI
ALIASQTWRDHPVDLLLSLLVQSLTGLLLGAGIQRLRELNQSLQKELARNQHLAERLLET
EESVRRDVARELHDDIGQTITAIRTQAGIVQRLAADNASVKQSGQLIEQLSLGVYDAVRR
LLGRLRPRQLDDLTLEQAIRSLMREMELEGRGIVSHLEWRIEESALSENQRVTLFRVCQE
GLNNIVKHADASAVTLQGWLQDERLMLVIEDDGSGLPPGSGQQGFGLTGMRERVTALGGT
LTISCLHGTRVSVSLPQRYV