Protein Info for MCAODC_05635 in Escherichia coli ECRC101

Name: yidG
Annotation: Inner membrane protein YidG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details PF02656: DUF202" amino acids 12 to 66 (55 residues), 43.9 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 100% identical to YIDG_ECOL6: Inner membrane protein YidG (yidG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to eco:b3675)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (120 amino acids)

>MCAODC_05635 Inner membrane protein YidG (Escherichia coli ECRC101)
MPDSRKARRIADPGLQPERTSLAWFRTMLGYGALMALAIKHNWHQAGMLFWISIGILAIV
ALILWHYTRNRNLMDVTNSDFSQFHVVRDKFLISLAVLSLAILFAVTHIHQLIVFIERVA