Protein Info for MCAODC_04865 in Escherichia coli ECRC101

Name: recQ
Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 15 to 603 (589 residues), 931.3 bits, see alignment E=2.2e-284 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 17 to 466 (450 residues), 696.6 bits, see alignment E=1.6e-213 PF04851: ResIII" amino acids 27 to 186 (160 residues), 23 bits, see alignment E=1.9e-08 PF00270: DEAD" amino acids 29 to 190 (162 residues), 92.1 bits, see alignment E=1e-29 PF00271: Helicase_C" amino acids 222 to 333 (112 residues), 83 bits, see alignment E=5.7e-27 PF16124: RecQ_Zn_bind" amino acids 344 to 406 (63 residues), 62.3 bits, see alignment E=1.8e-20 PF09382: RQC" amino acids 408 to 516 (109 residues), 121.1 bits, see alignment E=6.6e-39 PF00570: HRDC" amino acids 535 to 601 (67 residues), 82 bits, see alignment E=7.3e-27

Best Hits

Swiss-Prot: 100% identical to RECQ_ECOLI: ATP-dependent DNA helicase RecQ (recQ) from Escherichia coli (strain K12)

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 100% identity to eco:b3822)

MetaCyc: 100% identical to ATP-dependent DNA helicase RecQ (Escherichia coli K-12 substr. MG1655)
RXN-11135 [EC: 5.6.2.4]

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12 or 5.6.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (611 amino acids)

>MCAODC_04865 ATP-dependent DNA helicase RecQ (Escherichia coli ECRC101)
VNVAQAEVLNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQ
IPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQIRL
LYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPEYAALGQLRQRFPTLPFM
ALTATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKS
GIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQRDDLQIVVATVAFGM
GINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQG
QLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCGNCDICLDPPKQYDGSTDAQI
ALSTIGRVNQRFGMGYVVEVIRGANNQRIRDYGHDKLKVYGMGRDKSHEHWVSVIRQLIH
LGLVTQNIAQHSALQLTEAARPVLRGESSLQLAVPRIVALKPKAMQKSFGGNYDRKLFAK
LRKLRKSIADESNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMAL
IRAHVDGDDEE