Protein Info for MCAODC_04530 in Escherichia coli ECRC101

Name: yihT
Annotation: sulfofructosephosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01791: DeoC
  • amino acids 17 to 257 (241 residues), 195 bits, E=7.8e-62

Best Hits

Swiss-Prot: 100% identical to SQUT_ECO57: Sulfofructosephosphate aldolase (yihT) from Escherichia coli O157:H7

KEGG orthology group: K01671, [EC: 4.1.-.-] (inferred from 99% identity to eco:b3881)

MetaCyc: 99% identical to 6-deoxy-6-sulfofructose-1-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
RXN-15298 [EC: 4.1.2.57]

Predicted SEED Role

"Aldolase YihT"

MetaCyc Pathways

• sulfoquinovose degradation I (4/5 steps found)
• sulfoquinovose degradation VI (3/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.-.- or 4.1.2.57

Protein Sequence (292 amino acids)

>MCAODC_04530 sulfofructosephosphate aldolase (Escherichia coli ECRC101)
MNKYTINDITRASGGFAMLAVDQREAMRMMFAAAGAPAPVADSVLTDFKVNAAKTLSPYA
SAILVDQQFCYRQVVEQNAIAKSCAMIVAADEFIPGNGIPVDSVVIDRKINPLQIKQDGG
KALKLLVLWRSDEDAQQRLDMVKEFNELCHSHGLVSIIEPVVRPPRRGDKFDREQAIIDA
AKELGDSGADLYKVEMPLYGKGPQQELLSASQRLNDHINMPWVILSSGVDEKLFPRAVRV
AMTAGASGFLAGRAVWASVVGLPDNELMLRDVCAPKLQQLGDIVDEMMAKRR