Protein Info for MCAODC_04470 in Escherichia coli ECRC101

Name: fdhE
Annotation: formate dehydrogenase accessory protein FdhE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR01562: formate dehydrogenase accessory protein FdhE" amino acids 2 to 305 (304 residues), 523.2 bits, see alignment E=1.3e-161 PF04216: FdhE" amino acids 22 to 304 (283 residues), 391.2 bits, see alignment E=2.2e-121

Best Hits

Swiss-Prot: 100% identical to FDHE_ECO5E: Protein FdhE (fdhE) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K02380, FdhE protein (inferred from 99% identity to ecx:EcHS_A4119)

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>MCAODC_04470 formate dehydrogenase accessory protein FdhE (Escherichia coli ECRC101)
MSIRIIPQDELGSSEKRTADMIPPLLFPRLKNLYNRRAERLRELAENNPLGDYLRFAALI
AHAQEVVLYDHPLEMDLTARIKEASAQGKPPLDIHVLPRDKHWQKLLMALIAELKPEMSG
PALAVIENLEKASTQELEDMASALFASDFSSVSSDKAPFIWAALSLYWAQMANLIPGKAR
AEYGEQRQYCPVCGSMPVSSMVQIGTTQGLRYLHCNLCETEWHVVRVKCSNCEQSGKLHY
WSLDDEQAAIKAESCDDCGTYLKILYQEKEPKVEAVADDLASLVLDARMEQEGYARSSIN
PFLFPGEGE