Protein Info for MCAODC_04270 in Escherichia coli ECRC101

Name: glpF
Annotation: glycerol uptake facilitator protein GlpF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00230: MIP
  • amino acids 3 to 251 (249 residues), 237.6 bits, E=7.2e-75
• TIGR00861: MIP family channel proteins
  • amino acids 13 to 251 (239 residues), 253.4 bits, E=1e-79

Best Hits

Swiss-Prot: 100% identical to GLPF_ECOL6: Glycerol uptake facilitator protein (glpF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 100% identity to eco:b3927)

MetaCyc: 100% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

MetaCyc Pathways

• glycerol and glycerophosphodiester degradation (4/4 steps found)
• glycerol degradation I (3/3 steps found)
• arsenic detoxification (plants) (5/6 steps found)
• arsenate detoxification III (2/2 steps found)
• arsenic detoxification (mammals) (8/17 steps found)
• arsenic detoxification (yeast) (4/12 steps found)

Protein Sequence (281 amino acids)

>MCAODC_04270 glycerol uptake facilitator protein GlpF (Escherichia coli ECRC101)
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTA
GVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHH
IVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAP
LLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP
IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL