Protein Info for MCAODC_04240 in Escherichia coli ECRC101

Name: hslU
Annotation: HslU--HslV peptidase ATPase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 4 to 443 (440 residues), 791.5 bits, see alignment E=1.1e-242 PF07728: AAA_5" amino acids 52 to 150 (99 residues), 27.2 bits, see alignment E=1e-09 PF00004: AAA" amino acids 53 to 105 (53 residues), 30.9 bits, see alignment 1e-10 amino acids 241 to 332 (92 residues), 29 bits, see alignment E=3.8e-10 PF07724: AAA_2" amino acids 187 to 329 (143 residues), 100.6 bits, see alignment E=3e-32

Best Hits

Swiss-Prot: 100% identical to HSLU_ECOBW: ATP-dependent protease ATPase subunit HslU (hslU) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 100% identity to eco:b3931)

MetaCyc: 100% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>MCAODC_04240 HslU--HslV peptidase ATPase subunit (Escherichia coli ECRC101)
MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELRHEVTPKNILMIGPTG
VGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDAAVKMVRVQAIEKNR
YRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKLREGQLDDKEIEIDLAAA
PMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAMKLLIEEEAAKLVNPEELK
QDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDLLPLVEGCTVSTKHGMVKTD
HILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDFERILTEPNASITVQYKALMA
TEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVLERLMEEISYDASDLSGQNITI
DADYVSKHLDALVADEDLSRFIL