Protein Info for MCAODC_03765 in Escherichia coli ECRC101

Name: aceA
Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF00463: ICL" amino acids 8 to 255 (248 residues), 206 bits, see alignment E=9.5e-65 amino acids 257 to 434 (178 residues), 170.1 bits, see alignment E=7.3e-54 TIGR01346: isocitrate lyase" amino acids 8 to 255 (248 residues), 413 bits, see alignment E=8.2e-128 amino acids 256 to 434 (179 residues), 313.2 bits, see alignment E=1.4e-97 PF13714: PEP_mutase" amino acids 81 to 281 (201 residues), 54 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 100% identical to ACEA_ECOLI: Isocitrate lyase (aceA) from Escherichia coli (strain K12)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 100% identity to eco:b4015)

MetaCyc: 100% identical to isocitrate lyase (Escherichia coli K-12 substr. MG1655)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>MCAODC_03765 isocitrate lyase (Escherichia coli ECRC101)
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAV
VERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADL
ITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FAEAIHAKYPGKLLAYNCSPSFNWQKNLDDNTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF