Protein Info for MCAODC_03065 in Escherichia coli ECRC101

Name: adiY
Annotation: DNA-binding transcriptional activator AdiY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00165: HTH_AraC" amino acids 155 to 195 (41 residues), 27.2 bits, see alignment 3.3e-10 amino acids 209 to 243 (35 residues), 32.7 bits, see alignment 6.1e-12 PF12833: HTH_18" amino acids 169 to 244 (76 residues), 55.1 bits, see alignment E=8e-19

Best Hits

Swiss-Prot: 100% identical to ADIY_ECOLI: HTH-type transcriptional regulator AdiY (adiY) from Escherichia coli (strain K12)

KEGG orthology group: K03755, AraC family transcriptional regulator, transcriptional activator of adiA (inferred from 100% identity to ecr:ECIAI1_4346)

Predicted SEED Role

"Transcriptional regulator of catabolic arginine decarboxylase (adiA)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>MCAODC_03065 DNA-binding transcriptional activator AdiY (Escherichia coli ECRC101)
MRICSDQPCIVLLTEKDVWIRVNGKEPISLKANHMALLNCENNIIDVSSLNNTLVAHISH
DIIKDYLRFLNKDLSQIPVWQRSATPILTLPCLTPDVFRVAAQHSMMPAETESEKERTRA
LLFTVLSRFLDSKKFLSLMMYMLRNCVSDSVYQIIESDIHKDWNLSMVASCLCLSPSLLK
KKLKSENTSYSQIITTCRMRYAVNELMMDGKNISQVSQSCGYNSTSYFISVFKDFYGMTP
LHYVSQHRERTVA