Protein Info for MCAODC_02940 in Escherichia coli ECRC101

Name: aspA
Annotation: aspartate ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 TIGR00839: aspartate ammonia-lyase" amino acids 6 to 474 (469 residues), 915.2 bits, see alignment E=4.4e-280 PF00206: Lyase_1" amino acids 13 to 345 (333 residues), 377.1 bits, see alignment E=7.9e-117 PF10415: FumaraseC_C" amino acids 411 to 464 (54 residues), 64 bits, see alignment 1.3e-21

Best Hits

Swiss-Prot: 100% identical to ASPA_ECOL6: Aspartate ammonia-lyase (aspA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01744, aspartate ammonia-lyase [EC: 4.3.1.1] (inferred from 100% identity to eco:b4139)

MetaCyc: 100% identical to aspartate ammonia-lyase (Escherichia coli K-12 substr. MG1655)
Aspartate ammonia-lyase. [EC: 4.3.1.1]

Predicted SEED Role

"Aspartate ammonia-lyase (EC 4.3.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 4.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>MCAODC_02940 aspartate ammonia-lyase (Escherichia coli ECRC101)
MSNNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNNKISDIPEFVRGMVMVKKAAAM
ANKELQTIPKSVANAIIAACDEVLNNGKCMDQFPVDVYQGGAGTSVNMNTNEVLANIGLE
LMGHQKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYSSLIKLVDAINQLREGFERKAVE
FQDILKMGRTQLQDAVPMTLGQEFRAFSILLKEEVKNIQRTAELLLEVNLGATAIGTGLN
TPKEYSPLAVKKLAEVTGFPCVPAEDLIEATSDCGAYVMVHGALKRLAVKMSKICNDLRL
LSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVCFKVIGNDTTVTMAAEAGQLQ
LNVMEPVIGQAMFESVHILTNACYNLLEKCINGITANKEVCEGYVYNSIGIVTYLNPFIG
HHNGDIVGKICAETGKSVREVVLERGLLTEAELDDIFSVQNLMHPAYKAKRYTDESEQ