Protein Info for MCAODC_02755 in Escherichia coli ECRC101

Name: hflC
Annotation: protease modulator HflC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01932: HflC protein
  • amino acids 1 to 327 (327 residues), 496 bits, E=1.8e-153
• PF01145: Band_7
  • amino acids 21 to 243 (223 residues), 124.3 bits, E=2.9e-40

Best Hits

Swiss-Prot: 100% identical to HFLC_SHIFL: Modulator of FtsH protease HflC (hflC) from Shigella flexneri

KEGG orthology group: K04087, membrane protease subunit HflC [EC: 3.4.-.-] (inferred from 100% identity to eco:b4175)

MetaCyc: 100% identical to regulator of FtsH protease (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (334 amino acids)

>MCAODC_02755 protease modulator HflC (Escherichia coli ECRC101)
MRKSVIAIIIIVLVVLYMSVFVVKEGERGITLRFGKVLRDDDNKPLVYEPGLHFKIPFIE
TVKMLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYYLATGGGDISQAEVLLK
RKFSDRLRSEIGRLDVKDIVTDSRGRLTLEVRDALNSGSAGTEDEVTTPAADNAIAEAAE
RVTAETKGKVPVINPNSMAALGIEVVDVRIKQINLPTEVSEAIYNRMRAEREAVARRHRS
QGQEEAEKLRATADYEVTRTLAEAERQGRIMRGEGDAEAAKLFADAFSKDPDFYAFIRSL
RAYENSFSGNQDVMVMSPDSDFFRYMKTPTSATR