Protein Info for MCAODC_02680 in Escherichia coli ECRC101

Name: yjfP
Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 40 to 58 (19 residues), see Phobius details PF12146: Hydrolase_4" amino acids 28 to 132 (105 residues), 36.6 bits, see alignment E=9.5e-13 PF00561: Abhydrolase_1" amino acids 28 to 144 (117 residues), 31.7 bits, see alignment E=4e-11 PF12697: Abhydrolase_6" amino acids 31 to 207 (177 residues), 30.1 bits, see alignment E=2.3e-10 PF00326: Peptidase_S9" amino acids 52 to 234 (183 residues), 40.3 bits, see alignment E=7.9e-14

Best Hits

Swiss-Prot: 99% identical to YJFP_ECOLI: Esterase YjfP (yjfP) from Escherichia coli (strain K12)

KEGG orthology group: K06889, (no description) (inferred from 99% identity to eco:b4190)

MetaCyc: 99% identical to carboxylesterase (Escherichia coli K-12 substr. MG1655)
Carboxylesterase. [EC: 3.1.1.1]

Predicted SEED Role

"YjfP protein"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>MCAODC_02680 esterase (Escherichia coli ECRC101)
MIEIESRELADIPVLHAYPVGQKDTPLPCVIFYHGFTSSSLVYSYFAVALAQAGLRVIMP
DAPDHGSRFSGDAARRLNQFWQILLQSMQEFTTLRAAIAEEKWLLDDRLAVGGASMGAMT
ALGITARHPTVRCTASMMGSGYFTSLARSLFPPLIPETVAQQNEFNNIVAPLAEWEATNH
LEQLSDRPLLLWYGLDDDVVPADESLRLQQALSETGRDKLLTCSWQPGVRHRITPEALDA
AVTFFRQHL