Protein Info for MCAODC_02670 in Escherichia coli ECRC101

Name: ulaG
Annotation: L-ascorbate 6-phosphate lactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF13483: Lactamase_B_3" amino acids 42 to 281 (240 residues), 48.2 bits, see alignment E=1.2e-16 PF12706: Lactamase_B_2" amino acids 98 to 282 (185 residues), 49.3 bits, see alignment E=4.8e-17

Best Hits

Swiss-Prot: 100% identical to ULAG_ECOBW: Probable L-ascorbate-6-phosphate lactonase UlaG (ulaG) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K03476, L-ascorbate 6-phosphate lactonase [EC: 3.1.1.-] (inferred from 100% identity to eco:b4192)

MetaCyc: 100% identical to L-ascorbate-6-phosphate lactonase (Escherichia coli K-12 substr. MG1655)
3.1.1.-

Predicted SEED Role

"Probable L-ascorbate-6-phosphate lactonase UlaG (EC 3.1.1.-) (L-ascorbate utilization protein G)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 3.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>MCAODC_02670 L-ascorbate 6-phosphate lactonase (Escherichia coli ECRC101)
MSKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCV
DFWCGTGKQSHGNPLMKQGHQMQRMAGVKKLQPNLRTTPFVLDPFAIRQIDAVLATHDHN
DHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHAL
DAFDRTALITLPADQKAAGVLPDGMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEH
QIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWSNFQADPQEIRVLWE
MKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRGFDDCFTIEPDLPFKSFL