Protein Info for MCAODC_02670 in Escherichia coli ECRC101
Name: ulaG
Annotation: L-ascorbate 6-phosphate lactonase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ULAG_ECOBW: Probable L-ascorbate-6-phosphate lactonase UlaG (ulaG) from Escherichia coli (strain K12 / MC4100 / BW2952)
KEGG orthology group: K03476, L-ascorbate 6-phosphate lactonase [EC: 3.1.1.-] (inferred from 100% identity to eco:b4192)MetaCyc: 100% identical to L-ascorbate-6-phosphate lactonase (Escherichia coli K-12 substr. MG1655)
3.1.1.-
Predicted SEED Role
"Probable L-ascorbate-6-phosphate lactonase UlaG (EC 3.1.1.-) (L-ascorbate utilization protein G)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 3.1.1.-)
MetaCyc Pathways
- L-ascorbate degradation I (bacterial, anaerobic) (5/5 steps found)
KEGG Metabolic Maps
- 2,4-Dichlorobenzoate degradation
- Alkaloid biosynthesis II
- Ascorbate and aldarate metabolism
- Glycerophospholipid metabolism
- Retinol metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.1.-
Use Curated BLAST to search for 3.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (354 amino acids)
>MCAODC_02670 L-ascorbate 6-phosphate lactonase (Escherichia coli ECRC101) MSKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCV DFWCGTGKQSHGNPLMKQGHQMQRMAGVKKLQPNLRTTPFVLDPFAIRQIDAVLATHDHN DHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHAL DAFDRTALITLPADQKAAGVLPDGMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEH QIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWSNFQADPQEIRVLWE MKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRGFDDCFTIEPDLPFKSFL