Protein Info for MCAODC_02565 in Escherichia coli ECRC101

Name: ytfH
Annotation: Uncharacterized HTH-type transcriptional regulator YtfH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 PF01638: HxlR" amino acids 29 to 115 (87 residues), 109.5 bits, see alignment E=2.9e-36

Best Hits

Swiss-Prot: 100% identical to YTFH_SHIFL: Uncharacterized HTH-type transcriptional regulator YtfH (ytfH) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b4212)

Predicted SEED Role

"Redox-sensing transcriptional regulator QorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>MCAODC_02565 Uncharacterized HTH-type transcriptional regulator YtfH (Escherichia coli ECRC101)
MSQVSLSQQLKEGNLFAEQCPSREVLKHVTSRWGVLILVALREGTHRFSDLRRKIGGVSE
KMLAQSLQALEQDGFLNRIAYPVVPPHVEYSLTPLGEQVSEKVAALADWIELNLPEVLAV
RDERAA